PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10007024
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 273aa    MW: 30714.4 Da    PI: 6.3821
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10007024genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.54.6e-3871061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk++rrkC++ C++ap+fp +qp+kfa +hk+FGasnv k+l++lp   re+a+ sl yeA ar+rdPvyG+v+ i++l+++l+q + e+++ k
  Lus10007024   7 PCAACKLQRRKCTQVCIFAPHFPPDQPQKFADIHKVFGASNVAKMLSELPGMSREEAVISLSYEAGARIRDPVYGCVSAISELRHRLKQIHMEIDAGK 104
                  7********************************************************************************************99887 PP

       DUF260  99 ee 100
                  +e
  Lus10007024 105 QE 106
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.6326107IPR004883Lateral organ boundaries, LOB
PfamPF031955.4E-387102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MSHSQQPCAA CKLQRRKCTQ VCIFAPHFPP DQPQKFADIH KVFGASNVAK MLSELPGMSR  60
EEAVISLSYE AGARIRDPVY GCVSAISELR HRLKQIHMEI DAGKQELLKY MGSNTQQQNQ  120
ASMIPNSTTA GFNTAPTLHH QNQQQNMMMQ MMEGGGHHQM LDAQLMATEM QHQHQEMFKV  180
YEQSEQQQQH HHNHNHNNYG MLDDQVVDSV AANGFNQIGG SEFEPCLALG SMVNHEQSQV  240
EIPAHHEQLF FQLEHHEPEL SPPSSSPEFG VR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008241536.12e-54PREDICTED: LOB domain-containing protein 36
RefseqXP_008241537.12e-54PREDICTED: LOB domain-containing protein 36
RefseqXP_008241538.12e-54PREDICTED: LOB domain-containing protein 36
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-49ASYMMETRIC LEAVES 2-like 1